Liraglutide
aka Victoza
Mechanism
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Identification
| CAS number | 204656-20-2 |
|---|---|
| Molecular formula | C172H265N43O51 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR |
| Typical dose | 0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management) |
| Half-life | ~13 hours |
Vendors selling Liraglutide
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Peptidegurus | 30 mg | — | — | 84 |
| Genetic Peptide | 5 mg | $100.00 | — | — |
| Genetic Peptide | 30 mg | $100.00 | — | — |
Research
Aims To evaluate and compare the risk of diabetic retinopathy and kidney disease between once-daily liraglutide and once-weekly dulaglutide in Japanese participants with type 2 diabetes (T2D).
source →Objectives To determine the optimal timing for initiating liraglutide in patients with persistent obesity (BMI ≥ 28 kg/m² in China) six months after metabolic and bariatric surgery, a key gap in postoperative weight management.
source →Purpose Glucagon-like peptide-1 receptor agonists exhibit neuroprotective and anti-inflammatory effects; however, their role as perineural adjuvants in peripheral nerve blocks has not been investigated.
source →It is unknown whether the glucagon-like peptide-1 (GLP-1) receptor agonists have a significant protective effect against acute islet injury.
source →Liraglutide, a glucagon-like peptide-1 (GLP-1) receptor agonist, restores hyperglycemic conditions in patients with type 2 diabetes and has recently shown promising anti-inflammatory properties.
source →Glucagon-like peptide-1 receptor agonist liraglutide is widely used in type 2 diabetes mellitus and obesity and is generally considered non-hepatotoxic, with only rare reports of idiosyncratic liver injury.
source →Objective This study aimed to evaluate relationships between delayed gastric emptying and appetite suppression during treatment with liraglutide, a glucagon-like peptide-1 receptor agonist (GLP-1RA).
source →Liraglutide, a glucagon-like peptide-1 receptor agonist, is widely used as a therapeutic macromolecule for the treatment of type 2 diabetes; however, its large-scale production is limited by high manufacturing costs and the frequent occurrence of closely related deletion impurities during synthesis.
source →Aims The glucagon-like peptide-1 receptor agonists (GLP-1 RAs) semaglutide and liraglutide are approved for chronic weight management.
source →Aim To compare the effects of liraglutide, dapagliflozin, and their combination on renal inflammation, oxidative stress, and fibrosis in streptozotocin (STZ)-induced diabetes in rats.
source →This study is conducted in Europe. The aim of this study is to investigate the usage of liraglutide for weight management in clinical practice using the CPRD (Clinical Practice Research Datalink) primary care database.
source →Polycystic ovary syndrome (PCOS) is a health problem that affects one in 10 women of childbearing age, which is usually characterized by hormonal imbalance and metabolism problems such as hyperandrogenism and obesity.
source →Primary Objective: To demonstrate the superiority of the insulin glargine/lixisenatide fixed ratio combination (FRC) versus GLP-1 receptor agonist (GLP-1 RA) in hemoglobin A1c (HbA1c) change.
source →This is a single center, prospective, randomized, double blinded placebo controlled study conducted I patients with type 1 diabetes.The aim of this study is to examine the additive effects of GLP-1 agonist and SGLT2 inhibitor in patients with type 1 diabetes in terms of possible improved glycemic control, reduced glyce…
source →Liraglutide is a GLP1 agonist used in the treatment of Type 2 diabetes and is is asociated with improved blood glucose control, weight loss and low rates of hypoglycemia when used alone or in combination with metformin.
source →This trial is conducted in the United States of America (USA). The aim of this trial is to investigate the safety, tolerability and pharmacokinetics (exposure in the body) of liraglutide-depot in healthy subjects.
source →This trial is conducted in Europe. The aim of this trial is to test for bioequivalence of the phase 3a formulation of liraglutide at pH 8.15 (formulation 4) and liraglutide at pH 7.7 (formulation 3).
source →This trial is conducted in Europe and Oceania. The aim of this trial is to assess the effect on glycemic control of NNC 90-1170 (liraglutide) added to metformin compared to metformin given alone in subjects with type 2 diabetes previously treated with OHAs (oral hypoglycaemic agents).
source →