Cagrilintide
aka NN9838
Mechanism
Cagrilintide is a long-acting acylated amylin analog developed by Novo Nordisk. It is investigational and not FDA-approved; Novo Nordisk's lead development path is the CagriSema co-formulation with semaglutide for weight management. Monotherapy cagrilintide was evaluated in Phase 2 but was deprioritized in favor of the combination.
Identification
| CAS number | 1415456-99-3 |
|---|---|
| Molecular formula | C194H312N54O59S2 |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP |
| Typical dose | 0.3–4.5 mg once weekly subcutaneous (Phase 2); 2.4 mg/week maintenance in Phase 3 REDEFINE/REIMAGINE trials |
| Half-life | ~159–195 hours (~7–8 days) |
Vendors selling Cagrilintide
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Peptide Partners | 50 mg | $335.00 | — | 99 |
| Glacier Aminos | 5 mg | $56.99 | — | 99 |
| Glacier Aminos | 10 mg | $56.99 | — | 99 |
| Moglabs | 10 mg | $82.00 | — | 96 |
| BioLongevity Labs | 5 mg | $170.00 | — | 96 |
| Crush Research | 5 mg | $149.00 | — | 95 |
| Orbitrex Peptides | 10 mg | $219.99 | — | 95 |
| Profound Aminos | 5 mg | $69.00 | — | 95 |
| Licensed Peptides | 5 mg | $107.99 | — | 95 |
| Licensed Peptides | 10 mg | $107.99 | — | 95 |
| Peptide Tech | 10 mg | $59.99 | — | 94 |
| Mile High Compounds | — | $119.99 | — | 94 |
| Forge Performance Co. | 10 mg | $70.00 | — | 94 |
| Amino Club | — | $69.99 | — | 93 |
| Skye Peptides | 5 mg | $89.00 | — | 90 |
| Peptide Plugs | 10 mg | $60.00 | — | 89 |
| Qihang Peptide | — | — | — | 87 |
| Simple Peptide | 10 mg | $140.00 | — | 85 |
| Reta Peptide | 10 mg | $135.00 | — | 83 |
| Cocer Peptides | 10 mg | $260.00 | — | 82 |
| Crystal Peptides | 5 mg | $59.99 | — | 66 |
| Certified Peptides | 10 mg | $128.00 | — | 61 |
| Nox Amino | 10 mg | $95.00 | — | 55 |
| Peptiatlas | — | — | — | 51 |
| Taishijie | — | — | — | 51 |
| Taikangbio | — | — | — | 50 |
| Zjpeptix | — | — | — | 50 |
| Hkuppeptide | 5 mg | $10.00 | — | 50 |
| MEI-PEPETIDE | 5 mg | $140.00 | — | 48 |
| DongCheng Peptide | — | — | — | 46 |
| Puratek Peptides | — | $45.95 | — | 44 |
| Mandy | 5 mg | $84.00 | — | 43 |
| HongDa Peptide | — | $186.00 | — | 43 |
| HongDa Peptide | — | $129.00 | — | 43 |
| zztai Peptide Ltd | 5 mg | $100.00 | — | 43 |
| zztai Peptide Ltd | 10 mg | $180.00 | — | 43 |
| MJT peptides | 5 mg | $119.00 | — | 39 |
| HK Peptide Ltd (hk peptides) | — | — | — | 37 |
| NG Peptide | 5 mg | $40.00 | — | — |
| Welli Labs | — | $39.99 | — | — |
| synthesispeptides.io | — | $62.99 | — | — |
| Alpha Omega | 10 mg | $140.00 | — | — |
| Bulk Peptides | 10 mg | $400.00 | — | — |
| Flawless Compounds | — | — | — | — |
| Genetic Peptide | 5 mg | $90.00 | — | — |
| Genetic Peptide | 10 mg | $90.00 | — | — |
| Modern Research Peptides | — | $41.75 | — | — |
| Oasis Labs | 5 mg | $81.00 | — | — |
| Paramount Peptides | 10 mg | $157.25 | — | — |
| Peptide Crafters | 10 mg | $110.00 | — | — |
| Peptide Crafters | 5 mg | $65.00 | — | — |
| Pepvida Labs | 5 mg | $90.00 | — | — |
| Pepvida Labs | 10 mg | $170.00 | — | — |
| Platinum Lion | 10 mg | $109.99 | — | — |
| Polaris Peptides | 10 mg | $149.00 | — | — |
| Polaris Peptides | 10 mg | $140.00 | — | — |
| Polaris Peptides | 3 mg | $50.00 | — | — |
| Polaris Peptides | 5 mg | $80.00 | — | — |
| S1 Research | 5 mg | $29.99 | — | — |
| S1 Research | 10 mg | $29.99 | — | — |
| Soma Peptides | 10 mg | $124.00 | — | — |
| True Peptide | 10 mg | $105.00 | — | — |
| Wellness Peptides | 5 mg | $60.00 | — | — |
| Wellness Peptides | 10 mg | $60.00 | — | — |
| realpeptides.co | — | $160.00 | — | — |
Research
Background Obesity is a chronic, progressive disease affecting over 1 billion adults worldwide, linked to serious comorbidities, including diabetes, hypertension, and cardiovascular disease and associated with increased mortality. Achieving clinically meaningful weight loss is critical to reducing cardiometabolic risk.
source →Background Cagrilintide-semaglutide (CagriSema) is a novel, once-weekly combination of the amylin receptor agonist cagrilintide and the GLP-1 receptor agonist semaglutide.
source →Background Basal insulin treatment for type 2 diabetes often results in inadequate glycaemic control and is associated with weight gain and increased risk of hypoglycaemia.
source →Background and objectives Cagrilintide is a long-acting amylin agonist under development as monotherapy for weight management and as a fixed-dose combination with the glucagon-like peptide-1 receptor agonist semaglutide (CagriSema) for weight management and treatment of type 2 diabetes.
source →Background The amylin receptor agonist cagrilintide and the GLP-1 receptor agonist semaglutide have complementary effects on glycaemic control and bodyweight.
source →Background Obesity is a global health challenge associated with substantial cardiometabolic morbidity. Cagrilintide, a long-acting amylin analogue, alone or in combination with semaglutide (CagriSema), has emerged as a novel pharmacologic strategy for weight management.
source →Amylin receptor agonists such as cagrilintide represent emerging obesity therapies.
source →Aims The management of the disease of obesity has been transformed by incretin-based therapies; however, additional and alternative therapeutic strategies are needed to address its biological complexity.
source →Background The combination of cagrilintide and semaglutide has been shown in global studies to induce reductions in bodyweight. We assessed the efficacy and safety of a fixed-dose combination of cagrilintide 2·4 mg and semaglutide 2·4 mg versus semaglutide 2·4 mg for weight management in an east Asian population.
source →Background Incretin-based therapies such as glucagon-like peptide-1 receptor agonists (GLP-1Ras), dual GLP-1/GIP agonists and amylin analogues have demonstrated significant weight loss benefits. However, their impact on skeletal muscle mitochondrial function, particularly under metabolic stress, remains unclear.
source →This study will look at how well CagriSema and cagrilintide help children and adolescents with excess body weight lose weight. The study has 2 parts: main and extension study.
source →This study will look at the effects of CagriSema in people with both type 2 diabetes and painful diabetic peripheral neuropathy, compared to placebo. Participants will either get an active medicine or a "dummy" medicine (placebo). Which treatment participants get is decided by chance.
source →The study will look at the effects of NNC0194-0499, cagrilintide and semaglutide, on liver damage and alcohol use in participants with alcoholic liver disease. Participants will get NNC0194-0499, semaglutide, cagrilintide or ''dummy" medicine in different treatment combinations.
source →This study is testing a new study medicine to treat people living with overweight or obesity. The aim of this study is to see if the medicine is safe, how it works in human body, and what human body does to the study medicine.
source →This study will look at how well CagriSema compared to Tirzepatide helps people lower their body weight. CagriSema is a new investigational medicine developed by Novo Nordisk that combines Cagrilintide and Semaglutide. CagriSema is not yet being prescribed by doctors.
source →This study will look at how well the new medicine CagriSema helps people with excess body weight losing weight compared to a "dummy" medicine and a medicine called semaglutide. Participants will either get CagriSema, a dummy medicine or semaglutide. Which treatment participants get is decided by chance.
source →The study tests if treatment with cagrilintide delays the transmission of electrical signals in the heart compared to treatment with placebo. To confirm the sensitivity of the methodology, the drug moxifloxacin is also compared to a placebo in 2 treatment arms.
source →This study looks at how well a new medicine called cagrilintide works together with semaglutide on blood sugar levels in people with type 2 diabetes compared to cagrilintide alone or semaglutide alone. Before a new medicine can be prescribed to people it needs to be tested to see if it is safe and effective.
source →