IGF-1 LR3
aka Long R3 IGF-1
Mechanism
IGF-1 LR3 is an 83-amino-acid modified IGF-1 analog with a 13-residue N-terminal extension (MFPAMPLSSLFVN) and an Arg-3 substitution. These modifications reduce binding to IGF binding proteins (IGFBPs), extending effective half-life and increasing tissue bioavailability relative to native IGF-1. It is a research/cell-culture reagent and is NOT FDA-approved for any human use. Do not confuse with mecasermin (Increlex), which is recombinant human IGF-1 and IS FDA-approved for severe primary IGF-1 deficiency.
Identification
| CAS number | 143045-27-6 |
|---|---|
| Molecular formula | C400H619N111O115S9 |
| Sequence | MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Typical dose | 20-100 mcg/day subcutaneous or intramuscular injection (research use; commonly 20-50 mcg/day in published protocols) |
| Half-life | ~20-30 hours |
Vendors selling IGF-1 LR3
| Vendor | Size | Price | Listed purity | Trust |
|---|---|---|---|---|
| Moglabs | 1 mg | $68.00 | — | 96 |
| Licensed Peptides | — | $45.99 | — | 95 |
| Licensed Peptides | 1 mg | $45.99 | — | 95 |
| Peptide Tech | 1 mg | $88.99 | — | 94 |
| Mile High Compounds | — | $79.99 | — | 94 |
| Amino Club | 1 mg | $69.99 | — | 93 |
| Riptide Wellness | 1 mg | $76.76 | — | 92 |
| Hydro Research Peptides | — | $0.85 | — | 91 |
| Skye Peptides | 1 mg | $79.00 | — | 90 |
| Peptidology | 1 mg | $86.00 | — | 89 |
| Peptide Plugs | 1 mg | $70.00 | — | 89 |
| Arcane Peptides | 1 mg | $90.00 | — | 88 |
| Qihang Peptide | — | — | — | 87 |
| Verified Peptides | 1 mg | $65.00 | — | 86 |
| Peptidegurus | 1 mg | — | — | 84 |
| Peptidegurus | 1 mg | — | — | 84 |
| OROS Research | 1 mg | $69.99 | — | 79 |
| Crystal Peptides | 1 mg | $99.00 | — | 66 |
| Qing Li Peptide | — | — | — | 63 |
| Qing Li Peptide | 1 mg | — | — | 63 |
| Certified Peptides | 1 mg | $80.00 | — | 61 |
| Sports Technology Labs | 1 mg | $124.99 | — | 58 |
| Nox Amino | 1 mg | $125.00 | — | 55 |
| Peptiatlas | — | — | — | 51 |
| MEI-PEPETIDE | 0.1 mg | $43.00 | — | 48 |
| DongCheng Peptide | — | — | — | 46 |
| Puratek Peptides | 1 mg | $59.95 | — | 44 |
| Mandy | 0.1 mg | $29.00 | — | 43 |
| HongDa Peptide | — | $46.00 | — | 43 |
| MJT peptides | 0.1 mg | $43.00 | — | 39 |
| Nextech Labs | 1 mg | $90.00 | — | 24 |
| Cernum Biosciences | 1 mg | $104.99 | — | — |
| Kimera Chems | 1 mg | $81.99 | — | — |
| Welli Labs | — | $59.99 | — | — |
| synthesispeptides.io | — | $78.99 | — | — |
| Apollo Peptide Sciences | — | $79.99 | — | — |
| Bulk Peptides | — | $88.00 | — | — |
| Genetic Peptide | 1 mg | $200.00 | — | — |
| Genetic Peptide | — | $280.00 | — | — |
| Nova Peptides | 1 mg | $79.99 | — | — |
| Oasis Labs | 1 mg | $67.00 | — | — |
| Paramount Peptides | 1 mg | $85.00 | — | — |
| Peptide Crafters | 1 mg | $65.00 | — | — |
| Peptira | — | $69.00 | — | — |
| Platinum Lion | — | $49.99 | — | — |
| Polaris Peptides | 1 mg | $85.00 | — | — |
| S1 Research | 1 mg | $48.00 | — | — |
| Soma Peptides | 1 mg | $93.00 | — | — |
| Southern Aminos | 1 mg | $56.00 | — | — |
| True Peptide | 1 mg | $55.00 | — | — |
| optimasupply.is | — | $84.99 | — | — |
| realpeptides.co | 0.1 mg | $40.00 | — | — |
| realpeptides.co | 1 mg | $40.00 | — | — |
Research
Tissue engineering using the self-assembly approach represents a promising technology. However, age-related reductions in extracellular matrix deposition by stromal cells limit the mechanical robustness of reconstructed tissues what can be critical for midurethral sling reconstruction.
source →Performance-enhancing drugs (PEDs) marketed as "research compounds" include unregulated peptides intended to modulate the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis.
source →Mass spectrometry (MS)-based top-down proteomics (TDP) has emerged as a powerful tool for characterizing proteoforms to advance both fundamental and translational research. TDP requires high-efficiency liquid-phase separation, high-resolution MS, and tandem MS.
source →Therapeutic peptides are short chains of amino acids used to treat metabolic and endocrine conditions such as obesity and type 2 diabetes.
source →Peripheral nerve injuries lead to significant functional deficits, with no treatment achieving complete recovery. Autologous nerve grafting remains the gold standard, but it is limited by donor site morbidity. Artificial nerve conduits have been developed but have not matched the outcomes of autologous grafts.
source →Insulin-like growth factor-1 (IGF-1) and insulin are important fetal anabolic hormones.
source →Background Insulin-like growth factor-1 (IGF-1) promotes neurogenesis, cell survival, and glial function, making it a promising candidate therapy in Alzheimer's disease (AD). Objective Long arginine 3-IGF-1 (LR3-IGF-1) is a potent IGF-1 analogue.
source →Elevated cardiac troponin I (cTnI), a myocardial damage biomarker, has been reported in cord blood of neonates delivered vaginally or by cesarean section.
source →Chicken coccidiosis is an intestinal disease caused by the parasite Eimeria, which severely damages the growth of chickens and causes significant economic losses in the poultry industry.
source →Insulin-like growth factor-1 (IGF-1) is a critical fetal growth hormone that has been proposed as a therapy for intrauterine growth restriction. We previously demonstrated that a 1-week IGF-1 LR3 infusion into fetal sheep reduces in vivo and in vitro insulin secretion suggesting an intrinsic islet defect.
source →Insulin-like growth factor-1 (IGF-1) is a pleiotropic protein hormone and has become an attractive therapeutic target because of its multiple roles in various physiological processes, including growth, development, and metabolism.
source →Insulin and insulin-like growth factor-1 (IGF-1) are fetal hormones critical to establishing normal fetal growth. Experimentally elevated IGF-1 concentrations during late gestation increase fetal weight but lower fetal plasma insulin concentrations.
source →